PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA014811-PA
Common NameOsI_16464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 257aa    MW: 27096.6 Da    PI: 4.6705
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA014811-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.82e-07446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  BGIOSGA014811-PA  4 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
                      6******99*********************6678888898877 PP

2zf-B_box26.71.2e-085586334
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                       ++C+ ++ek + +fC +++ l+C+dC + +H
  BGIOSGA014811-PA 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86
                      589**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.096147IPR000315B-box-type zinc finger
PfamPF006433.0E-5447IPR000315B-box-type zinc finger
SMARTSM003364.6E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501198.51753100IPR000315B-box-type zinc finger
SMARTSM003366.4E-1453100IPR000315B-box-type zinc finger
PfamPF006432.6E-65696IPR000315B-box-type zinc finger
CDDcd000211.18E-75686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0048573Biological Processphotoperiodism, flowering
GO:0080167Biological Processresponse to karrikin
GO:0090351Biological Processseedling development
GO:1902448Biological Processpositive regulation of shade avoidance
GO:0005634Cellular Componentnucleus
GO:0003712Molecular Functiontranscription cofactor activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MRIQCDACEA AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAA LSAALPRCDV  60
CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGNHQRYLA TGIRVGFSSV CSANADHLPP  120
PAPKGNSKPP ASGIAAAAAP KPAVSAAAQE VPSSPFLPPS GWAVEDLLQL SDYESSDKKG  180
SPIGFKDLEW LDDIDLFHVQ SPAKGGSTAA EVPELFASPQ PASNMGLYKA SGARQSKKPR  240
VEIPDDDEDF FIVPDLG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1000630.0callus| flower| leaf| panicle| root| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8417670.0CT841767.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C103C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636444.10.0PREDICTED: B-box zinc finger protein 24
SwissprotQ962887e-76BBX24_ARATH; B-box zinc finger protein 24
TrEMBLB8ARC30.0B8ARC3_ORYSI; Putative uncharacterized protein
TrEMBLQ25AC10.0Q25AC1_ORYSA; H0425E08.14 protein
STRINGBGIOSGA014811-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.12e-51DBB family protein